PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g076030.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 335aa    MW: 36053.4 Da    PI: 9.282
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g076030.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.7e-3869128362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e+ lkcprCdstntkfCy+nny+lsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk+s+
  Sopim06g076030.0.1  69 EAGLKCPRCDSTNTKFCYFNNYNLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRSK 128
                         6779*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3652121IPR003851Zinc finger, Dof-type
PfamPF027013.9E-3271126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.58172126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVFSSFPVYL DHPNLHQLQQ ADGHQQGNTG LELPTVQPPP PMQVGASPGS IRPGSMVDRA  60
RLAKIPLPEA GLKCPRCDST NTKFCYFNNY NLSQPRHFCK TCRRYWTRGG ALRSVPVGGG  120
CRRNKRSKSS SNNNNNNSSK STGGSNVNTN KTIASGTSTS ASPSSCSTEI MNGRHHFPHE  180
QPTQLTPLMA AFQNLNHHYG GFQPNLVSTH HGNGSALSSH HHEMGFQIGN STNTNNTNNL  240
PVPSGGGSDH QWRLPSLAAN TNLYPFQHGS DQGIHESSSG NNNNINGHHD EQGLNSTKQF  300
LGTMENNSNQ YWGGNAWTGG FSGLNSSSSA SHLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241234.10.0PREDICTED: dof zinc finger protein DOF2.4
TrEMBLK4C9W40.0K4C9W4_SOLLC; Uncharacterized protein
STRINGSolyc06g076030.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-44OBF-binding protein 3